PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10033174
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 433aa    MW: 47529.2 Da    PI: 6.6613
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10033174genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.15.2e-10292350563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  kr +r   NR++A rs +RK  +i+eLe kv+ L+ae +aL  ++  l+  +a+l+s++
  Lus10033174 292 KRVKRILANRLSAARSKERKMRYIAELELKVQGLQAEATALSAQVTVLQRDSANLTSQN 350
                  899*****************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.2E-17288352IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.68290353IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.69E-10292348No hitNo description
Gene3DG3DSA:1.20.5.1702.9E-10292349No hitNo description
PfamPF001701.4E-8292350IPR004827Basic-leucine zipper domain
CDDcd147034.26E-21293344No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MCATMRQSSP NLDPQESNKR IGLPPSHPNN SHFFADQHHQ QGGTSHLRSL SQSSMFSIDF  60
RPMEQNNAAS SQGILAPVSS RVNDGGLPPL RAAAHKRAIS DTVPLGFCDM IQSSPQLVPI  120
RGQVGGFDRL ELVKQESEVA ATDEMMMMSA YMHMDNVDPL HSSGTEDNKD LDSRASGTKT  180
NGTESSDNEA ESHVKGIKRT ADGEIGPAGR HCRSVSMDSF MGGLRLDEES MIMKLPPLGV  240
RVGQHHSPSS SSMQGNLSKF NLEFGNGEFT ELELKKIMSN DKLTELAMAD PKRVKRILAN  300
RLSAARSKER KMRYIAELEL KVQGLQAEAT ALSAQVTVLQ RDSANLTSQN NELKFRLQSI  360
EQQAQLKDAL NEALVAEVQR LRLAASEVGA DSHHHHEQQP QQLPVNHQMI QPGQANTYQQ  420
QQELNQAQNS SN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012073848.11e-143PREDICTED: transcription factor VIP1-like
TrEMBLA0A067KLE41e-143A0A067KLE4_JATCU; Uncharacterized protein
STRINGVIT_03s0038g00860.t011e-118(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-89bZIP family protein